PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10005483m
Common NameCARUB_v10005483mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 272aa    MW: 30578.1 Da    PI: 5.5809
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10005483mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.21e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l++ +   G  +W++ ++  g++R++k+c++rw +yl
  Carubv10005483m 14 KGPWTVEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.42.4e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      + +E++l +d+++ lG++ W++Ia++++ gRt++++k++w+++
  Carubv10005483m  71 SHDEEQLVIDLHAHLGNK-WSKIASRLP-GRTDNEIKNHWNTH 111
                      789***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-20562IPR009057Homeodomain-like
PROSITE profilePS5129412.787961IPR017930Myb domain
SuperFamilySSF466891.31E-2611108IPR009057Homeodomain-like
SMARTSM007171.1E-111363IPR001005SANT/Myb domain
PfamPF002491.6E-131461IPR001005SANT/Myb domain
CDDcd001677.20E-91661No hitNo description
PROSITE profilePS5129427.37162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2463117IPR009057Homeodomain-like
SMARTSM007173.8E-1466114IPR001005SANT/Myb domain
CDDcd001674.92E-1171112No hitNo description
PfamPF002491.2E-1471111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTVE EDKKLINFIL TNGHCCWRAL PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SHDEEQLVID LHAHLGNKWS KIASRLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPMTHQPLN QEPSNTDPSK TISSNPDDIS KEPKTASTKT LDIISGTTTT EDESSSTVTD  180
QNSSMDNENH LLDNNYNDDE LFSYLWSDET TKADASLGDS NYGAVGGTLY DSNNISTTVS  240
DLPIWSPEGI NDKDWMFLDY CQDFGVHDFG F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284312.10.0hypothetical protein CARUB_v10005483mg
SwissprotQ50EX61e-91ODO1_PETHY; Protein ODORANT1
TrEMBLR0GY120.0R0GY12_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.7__2034__AT4G22680.11e-158(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.11e-159myb domain protein 85